Lineage for d1s7aa_ (1s7a A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 906051Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 907001Family a.4.5.46: La domain [101051] (2 proteins)
    Pfam PF05383; RNA-binding domain
  6. 907005Protein Lupus La autoantigen N-terminal domain [101052] (2 species)
  7. 907006Species Human (Homo sapiens) [TaxId:9606] [101053] (7 PDB entries)
  8. 907018Domain d1s7aa_: 1s7a A: [98633]

Details for d1s7aa_

PDB Entry: 1s7a (more details)

PDB Description: nmr structure of the la motif of human la protein
PDB Compounds: (A:) Lupus La protein

SCOPe Domain Sequences for d1s7aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7aa_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
maengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnr
lttdfnvivealskskaelmeisedktkirrspskplpevtde

SCOPe Domain Coordinates for d1s7aa_:

Click to download the PDB-style file with coordinates for d1s7aa_.
(The format of our PDB-style files is described here.)

Timeline for d1s7aa_: