PDB entry 1s7a

View 1s7a on RCSB PDB site
Description: NMR structure of the La motif of human La protein
Class: RNA binding protein, translation
Keywords: La motif, alpha/beta, winged helix domain, RNA BINDING PROTEIN, TRANSLATION
Deposited on 2004-01-29, released 2004-04-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lupus La protein
    Species: Homo sapiens [TaxId:9606]
    Gene: ssb
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1s7aa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s7aA (A:)
maengdnekmaaleakichqieyyfgdfnlprdkflkeqikldegwvpleimikfnrlnr
lttdfnvivealskskaelmeisedktkirrspskplpevtde