Lineage for d1nzpa_ (1nzp A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 916790Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 917086Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 917087Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 917211Protein DNA polymerase lambda [101251] (1 species)
  7. 917212Species Human (Homo sapiens) [TaxId:9606] [101252] (17 PDB entries)
  8. 917240Domain d1nzpa_: 1nzp A: [92385]
    one (lyase) domain only
    protein/DNA complex

Details for d1nzpa_

PDB Entry: 1nzp (more details)

PDB Description: solution structure of the lyase domain of human dna polymerase lambda
PDB Compounds: (A:) DNA polymerase lambda

SCOPe Domain Sequences for d1nzpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nzpa_ a.60.6.1 (A:) DNA polymerase lambda {Human (Homo sapiens) [TaxId: 9606]}
aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs
ipgigkrmaekiieilesghlrkldh

SCOPe Domain Coordinates for d1nzpa_:

Click to download the PDB-style file with coordinates for d1nzpa_.
(The format of our PDB-style files is described here.)

Timeline for d1nzpa_: