Class a: All alpha proteins [46456] (202 folds) |
Fold a.60: SAM domain-like [47768] (13 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
Protein DNA polymerase lambda [101251] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [101252] (2 PDB entries) |
Domain d1nzpa_: 1nzp A: [92385] one (lyase) domain only |
PDB Entry: 1nzp (more details)
SCOP Domain Sequences for d1nzpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nzpa_ a.60.6.1 (A:) DNA polymerase lambda {Human (Homo sapiens)} aqpssqkatnhnlhiteklevlakaysvqgdkwralgyakainalksfhkpvtsyqeacs ipgigkrmaekiieilesghlrkldh
Timeline for d1nzpa_: