Lineage for d1nmla1 (1nml A:1-166)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.3: Cytochrome c [46625] (1 superfamily)
core: 3 helices; folded leaf, openedSuperfamily a.3.1: Cytochrome c [46626] (9 families) 
covalently-bound heme completes the core
Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
duplication: contains two cytochrome c-type domainsProtein Di-heme cytochrome c peroxidase [46686] (3 species) 
Species Pseudomonas nautica [TaxId:2743] [100993] (3 PDB entries)
Uniprot P83787
Domain d1nmla1: 1nml A:1-166 [91976]
complexed with cit, hem
Details for d1nmla1
PDB Entry: 1nml (more details), 2.2 Å
PDB Description: di-haemic cytochrome c peroxidase from pseudomonas nautica 617, form in (ph 4.0)
PDB Compounds: (A:) di-haem cytochrome c peroxidaseSCOPe Domain Sequences for d1nmla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nmla1 a.3.1.5 (A:1-166) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitp
SCOPe Domain Coordinates for d1nmla1:
Click to download the PDB-style file with coordinates for d1nmla1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nmla1:
- d1nmla1 first appeared in SCOP 1.67
- d1nmla1 appears in SCOPe 2.04
- d1nmla1 appears in SCOPe 2.06
- d1nmla1 appears in the current release, SCOPe 2.08
View in 3D
