Lineage for d1nmla1 (1nml A:1-166)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1980705Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1980706Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1981360Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 1981361Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 1981378Species Pseudomonas nautica [TaxId:2743] [100993] (3 PDB entries)
    Uniprot P83787
  8. 1981379Domain d1nmla1: 1nml A:1-166 [91976]
    complexed with cit, hem

Details for d1nmla1

PDB Entry: 1nml (more details), 2.2 Å

PDB Description: di-haemic cytochrome c peroxidase from pseudomonas nautica 617, form in (ph 4.0)
PDB Compounds: (A:) di-haem cytochrome c peroxidase

SCOPe Domain Sequences for d1nmla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmla1 a.3.1.5 (A:1-166) Di-heme cytochrome c peroxidase {Pseudomonas nautica [TaxId: 2743]}
dnlmeransmfepipkyppvidgneltqakvelgkmeffeprlssshliscntchnvglg
gddelptsighgwqkgprnsptvfnavfnaaqfwdgraadlaeqakgpvqagvemsstpd
rvvatlksmpeyierfedafpgqenpvtfdnmavaieayeatlitp

SCOPe Domain Coordinates for d1nmla1:

Click to download the PDB-style file with coordinates for d1nmla1.
(The format of our PDB-style files is described here.)

Timeline for d1nmla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nmla2