Lineage for d1mmca_ (1mmc A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2257051Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (3 families) (S)
  5. 2257226Family g.3.1.2: Antimicrobial peptide 2, AC-AMP2 [57024] (2 proteins)
    automatically mapped to Pfam PF00187
  6. 2257227Protein Antimicrobial peptide 2, AC-AMP2 [57025] (1 species)
  7. 2257228Species Tassel (Amaranthus caudatus) [TaxId:3567] [57026] (1 PDB entry)
  8. 2257229Domain d1mmca_: 1mmc A: [44061]

Details for d1mmca_

PDB Entry: 1mmc (more details)

PDB Description: 1h nmr study of the solution structure of ac-amp2
PDB Compounds: (A:) antimicrobial peptide 2

SCOPe Domain Sequences for d1mmca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mmca_ g.3.1.2 (A:) Antimicrobial peptide 2, AC-AMP2 {Tassel (Amaranthus caudatus) [TaxId: 3567]}
vgecvrgrcpsgmccsqfgycgkgpkycgr

SCOPe Domain Coordinates for d1mmca_:

Click to download the PDB-style file with coordinates for d1mmca_.
(The format of our PDB-style files is described here.)

Timeline for d1mmca_: