SCOP 1.55: Domain d1mmc__: 1mmc -

Lineage for d1mmc__ (1mmc -)

1. Root: SCOP 1.55

2. Class g: Small proteins [56992] (54 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (16 superfamilies)

4. Superfamily g.3.1: Plant lectins/antimicrobial peptides [57016] (2 families)

5. Family g.3.1.2: Antimicrobial peptide 2, AC-AMP2 [57024] (1 protein)

6. Protein Antimicrobial peptide 2, AC-AMP2 [57025] (1 species)

7. Species Tassel (Amaranthus caudatus) [TaxId:3567] [57026] (1 PDB entry)

8. Domain d1mmc__: 1mmc - [44061]

Details for d1mmc__

PDB Entry: 1mmc

PDB Description: 1h nmr study of the solution structure of ac-amp2

SCOP Domain Sequences for d1mmc__:

Sequence; same for both SEQRES and ATOM records:

>d1mmc__ g.3.1.2 (-) Antimicrobial peptide 2, AC-AMP2 {Tassel (Amaranthus caudatus)}
vgecvrgrcpsgmccsqfgycgkgpkycgr

Timeline for d1mmc__:

• d1mmc__ appears in SCOP 1.57
  
• d1mmc__ appears in the current release, SCOPe 2.08, called d1mmca_