Lineage for d1mh2a_ (1mh2 A:)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
common core: 2 helices, disulfide-linked, and a calcium-binding loopSuperfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) 
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
automatically mapped to Pfam PF00068
Protein Snake phospholipase A2 [48624] (38 species) 
Species Andaman cobra (Naja sagittifera), isoform 2 [TaxId:195058] [89169] (4 PDB entries)
heterodimer of two different isoforms
Domain d1mh2a_: 1mh2 A: [84960]
zinc containing heterodimer of two different isoforms
complexed with acy, zn
Details for d1mh2a_
PDB Entry: 1mh2 (more details), 2.7 Å
PDB Description: Crystal Structure of a Zinc Containing Dimer of Phospholipase A2 from the Venom of Indian Cobra (Naja Naja Sagittifera)
PDB Compounds: (A:) phospholipase a2SCOPe Domain Sequences for d1mh2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mh2a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), isoform 2 [TaxId: 195058]}
ntyqfqnmiqctvpkrswrdfadygcycgrggsgtpiddldsccqvhdncynsareqggc
rpkqktytyqckagglscsgannscaattcdcdrlaaicfagapyndnnynidlkarcq
SCOPe Domain Coordinates for d1mh2a_:
Click to download the PDB-style file with coordinates for d1mh2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mh2a_:
- d1mh2a_ first appeared in SCOP 1.65
- d1mh2a_ appears in SCOPe 2.07
View in 3D
