Lineage for d1jpca_ (1jpc A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813364Fold b.78: beta-Prism II [51109] (1 superfamily)
    consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
    duplication: consists of two domains of this fold
  4. 2813365Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families) (S)
  5. 2813366Family b.78.1.1: alpha-D-mannose-specific plant lectins [51111] (4 proteins)
  6. 2813388Protein Lectin (agglutinin) [51112] (4 species)
  7. 2813405Species Snowdrop (Galanthus nivalis) [TaxId:4670] [51113] (3 PDB entries)
  8. 2813406Domain d1jpca_: 1jpc A: [27986]

Details for d1jpca_

PDB Entry: 1jpc (more details), 2 Å

PDB Description: mannose-specific agglutinin (lectin) from snowdrop (galanthus nivalis) bulbs in complex with mannose-alpha1,6-(mannose-alpha1,3)-mannose- alpha1,6-(mannose-alpha1,3)-mannose
PDB Compounds: (A:) agglutinin

SCOPe Domain Sequences for d1jpca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jpca_ b.78.1.1 (A:) Lectin (agglutinin) {Snowdrop (Galanthus nivalis) [TaxId: 4670]}
dnilysgetlstgeflnygsfvfimqedcnlvlydvdkpiwatntgglsrscflsmqtdg
nlvvynpsnkpiwasntggqngnyvcilqkdrnvviygtdrwatgtht

SCOPe Domain Coordinates for d1jpca_:

Click to download the PDB-style file with coordinates for d1jpca_.
(The format of our PDB-style files is described here.)

Timeline for d1jpca_: