Lineage for d1f2va_ (1f2v A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1158036Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1160391Superfamily c.23.17: Precorrin-8X methylmutase CbiC/CobH [63965] (1 family) (S)
    fold elaborated with additional structures
  5. 1160392Family c.23.17.1: Precorrin-8X methylmutase CbiC/CobH [63966] (3 proteins)
  6. 1160393Protein Precorrin-8x methylmutase [63967] (2 species)
  7. 1160394Species Pseudomonas denitrificans [TaxId:43306] [63968] (2 PDB entries)
  8. 1160395Domain d1f2va_: 1f2v A: [59627]

Details for d1f2va_

PDB Entry: 1f2v (more details), 2.1 Å

PDB Description: crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis
PDB Compounds: (A:) precorrin-8x methylmutase

SCOPe Domain Sequences for d1f2va_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f2va_ c.23.17.1 (A:) Precorrin-8x methylmutase {Pseudomonas denitrificans [TaxId: 43306]}
peydyirdgnaiyersfaiiraeadlsrfseeeadlavrmvhacgsveatrqfvfspdfv
ssaraalkagapilcdaemvahgvtrarlpagnevictlrdprtpalaaeigntrsaaal
klwserlagsvvaignaptalffllemlrdgapkpaailgmpvgfvgaaeskdalaensy
gvpfaivrgrlggsamtaaalnslarpgl

SCOPe Domain Coordinates for d1f2va_:

Click to download the PDB-style file with coordinates for d1f2va_.
(The format of our PDB-style files is described here.)

Timeline for d1f2va_: