Lineage for d1f2va_ (1f2v A:)
- Root: SCOP 1.57
Class c: Alpha and beta proteins (a/b) [51349] (107 folds) 
Fold c.23: Flavodoxin-like [52171] (17 superfamilies) 
Superfamily c.23.17: Precorrin-8x methylmutase [63965] (1 family) 
Family c.23.17.1: Precorrin-8x methylmutase [63966] (1 protein) Protein Precorrin-8x methylmutase [63967] (1 species) Species Pseudomonas denitrificans [TaxId:43306] [63968] (2 PDB entries) 
Domain d1f2va_: 1f2v A: [59627]
Details for d1f2va_
PDB Entry: 1f2v (more details), 2.1 Å
PDB Description: crystal structure analysis of precorrin-8x methylmutase of aerobic vitamin b12 synthesis
SCOP Domain Sequences for d1f2va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1f2va_ c.23.17.1 (A:) Precorrin-8x methylmutase {Pseudomonas denitrificans}
peydyirdgnaiyersfaiiraeadlsrfseeeadlavrmvhacgsveatrqfvfspdfv
ssaraalkagapilcdaemvahgvtrarlpagnevictlrdprtpalaaeigntrsaaal
klwserlagsvvaignaptalffllemlrdgapkpaailgmpvgfvgaaeskdalaensy
gvpfaivrgrlggsamtaaalnslarpgl
SCOP Domain Coordinates for d1f2va_:
Click to download the PDB-style file with coordinates for d1f2va_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1f2va_:
- d1f2va_ is new in SCOP 1.57
- d1f2va_ appears in SCOP 1.59
- d1f2va_ appears in the current release, SCOPe 2.08
View in 3D