Lineage for d1eg0f_ (1eg0 F:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3042557Family i.1.1.1: Ribosome complexes [58120] (3 proteins)
  6. 3042558Protein 70S ribosome functional complex [58121] (4 species)
  7. 3042559Species Escherichia coli [TaxId:562] [58123] (72 PDB entries)
  8. 3042625Domain d1eg0f_: 1eg0 F: [45812]
    Other proteins in same PDB: d1eg0a2

Details for d1eg0f_

PDB Entry: 1eg0 (more details), 11.5 Å

PDB Description: fitting of components with known structure into an 11.5 a cryo-em map of the e.coli 70s ribosome
PDB Compounds: (F:) protein (s15 ribosomal protein)

SCOPe Domain Sequences for d1eg0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eg0f_ i.1.1.1 (F:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]}
pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
qrrrllrylqredperyralieklgirg

SCOPe Domain Coordinates for d1eg0f_:

Click to download the PDB-style file with coordinates for d1eg0f_.
(The format of our PDB-style files is described here.)

Timeline for d1eg0f_: