Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.1: Ribosome complexes [58120] (3 proteins) |
Protein 70S ribosome functional complex [58121] (4 species) |
Species Escherichia coli [TaxId:562] [58123] (72 PDB entries) |
Domain d1eg0c_: 1eg0 C: [45809] Other proteins in same PDB: d1eg0a2 |
PDB Entry: 1eg0 (more details), 11.5 Å
SCOPe Domain Sequences for d1eg0c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eg0c_ i.1.1.1 (C:) 70S ribosome functional complex {Escherichia coli [TaxId: 562]} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepf
Timeline for d1eg0c_: