Lineage for d1e79h2 (1e79 H:15-100)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428736Fold b.93: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51343] (1 superfamily)
    pseudobarrel: sandwich of two sheets packed at a positive interstrand angle and interconnected with many short turns
  4. 2428737Superfamily b.93.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51344] (1 family) (S)
  5. 2428738Family b.93.1.1: Epsilon subunit of F1F0-ATP synthase N-terminal domain [51345] (2 proteins)
  6. 2428739Protein Epsilon subunit of F1F0-ATP synthase N-terminal domain [51346] (3 species)
    delta subunit in mitochondria
  7. 2428748Species Cow (Bos taurus) [TaxId:9913] [51348] (5 PDB entries)
  8. 2428752Domain d1e79h2: 1e79 H:15-100 [28438]
    Other proteins in same PDB: d1e79a1, d1e79a2, d1e79a3, d1e79b1, d1e79b2, d1e79b3, d1e79c1, d1e79c2, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79i_
    complexed with adp, atp, dcw, gol, mg, so4

Details for d1e79h2

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)
PDB Compounds: (H:) ATP synthase delta chain

SCOPe Domain Sequences for d1e79h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79h2 b.93.1.1 (H:15-100) Epsilon subunit of F1F0-ATP synthase N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
qmsftfasptqvffnsanvrqvdvptqtgafgilaahvptlqvlrpglvvvhaedgttsk
yfvssgsvtvnadssvqllaeeavtl

SCOPe Domain Coordinates for d1e79h2:

Click to download the PDB-style file with coordinates for d1e79h2.
(The format of our PDB-style files is described here.)

Timeline for d1e79h2: