![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies) barrel, closed; n=6, S=8; greek-key Many cradle-loop superfamilies may be homologous, according to PubMed 18457946 |
![]() | Superfamily b.49.1: N-terminal domain of alpha and beta (or A/B) subunits of rotary ATPases [50615] (3 families) ![]() automatically mapped to Pfam PF02874 |
![]() | Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
![]() | Protein F1 ATP synthase alpha subunit, domain 1 [88672] (5 species) |
![]() | Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries) Uniprot P19483 |
![]() | Domain d1e79c2: 1e79 C:19-94 [26436] Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d2, d1e79d3, d1e79e1, d1e79e2, d1e79e3, d1e79f1, d1e79f2, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_ complexed with adp, atp, dcw, gol, mg, so4 |
PDB Entry: 1e79 (more details), 2.4 Å
SCOPe Domain Sequences for d1e79c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e79c2 b.49.1.1 (C:19-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn dklikegdivkrtgai
Timeline for d1e79c2: