SCOPe 2.03: Domain d1e6vb1: 1e6v B:190-442

Lineage for d1e6vb1 (1e6v B:190-442)

Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds)
Fold a.89: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48080] (1 superfamily)
multihelical bundle; contains buried central helix
Superfamily a.89.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48081] (2 families)
Family a.89.1.1: Methyl-coenzyme M reductase alpha and beta chain C-terminal domain [48082] (2 proteins)
C-terminal domain is all-alpha
Protein Beta chain [48087] (3 species)
Species Methanopyrus kandleri [TaxId:2320] [48089] (1 PDB entry)
Domain d1e6vb1: 1e6v B:190-442 [18533]
Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb2, d1e6vc_, d1e6vd1, d1e6vd2, d1e6ve2, d1e6vf_
complexed with com, f43, tp7

Details for d1e6vb1

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri

PDB Compounds: (B:) methyl-coenzyme m reductase I beta subunit

SCOPe Domain Sequences for d1e6vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6vb1 a.89.1.1 (B:190-442) Beta chain {Methanopyrus kandleri [TaxId: 2320]}
gyalrnimvnhivaatrkntmqavclaatlqqtamfemgdalgpferlhllgyayqglna
dnmvydivkkhgkegtvgtvvrevveraledgvievkeelpsfkvykandmdlwnayaaa
glvaavmvnqgaaraaqgvsatilyyndlleyetglpgvdfgraegtavgfsffshsiyg
gggpgifhgnhivtrhskgfaippvaaamaldagtqmfspevtskligdvfgeidefrep
mkyiteaaaeeak

SCOPe Domain Coordinates for d1e6vb1:

Click to download the PDB-style file with coordinates for d1e6vb1.
(The format of our PDB-style files is described here.)

Timeline for d1e6vb1: