Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures |
Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins) C-terminal domain is all-alpha |
Protein Beta chain [55099] (3 species) |
Species Methanopyrus kandleri [TaxId:2320] [55101] (1 PDB entry) |
Domain d1e6ve2: 1e6v E:7-189 [39452] Other proteins in same PDB: d1e6va1, d1e6va2, d1e6vb1, d1e6vc_, d1e6vd1, d1e6vd2, d1e6ve1, d1e6vf_ complexed with com, f43, tp7 |
PDB Entry: 1e6v (more details), 2.7 Å
SCOPe Domain Sequences for d1e6ve2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e6ve2 d.58.31.2 (E:7-189) Beta chain {Methanopyrus kandleri [TaxId: 2320]} dtvdlyddrgncvaeevpievlspmrneaiqsivndikrtvavdlegienalqnatvggk gmkipgremdvdivdnaeaiadeiekmirvyqdddtnvepmydgkrllvqlpservkvma dpysgtlqagmavvhaiidvcevdmwdanmvkaavfgrypqtidyfggnvasmldvpmkq egv
Timeline for d1e6ve2: