Lineage for d1e6va2 (1e6v A:8-272)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1417867Superfamily d.58.31: Methyl-coenzyme M reductase subunits [55088] (3 families) (S)
    each of the three different subunits, alpha, beta and gamma, contains this fold decorated with additional secondary structures
  5. 1417901Family d.58.31.2: Methyl-coenzyme M reductase alpha and beta chain N-terminal domain [55094] (2 proteins)
    C-terminal domain is all-alpha
  6. 1417902Protein Alpha chain [55095] (3 species)
  7. 1417926Species Methanopyrus kandleri [TaxId:2320] [55097] (1 PDB entry)
  8. 1417927Domain d1e6va2: 1e6v A:8-272 [39445]
    Other proteins in same PDB: d1e6va1, d1e6vb1, d1e6vb2, d1e6vc_, d1e6vd1, d1e6ve1, d1e6ve2, d1e6vf_
    complexed with com, f43, tp7

Details for d1e6va2

PDB Entry: 1e6v (more details), 2.7 Å

PDB Description: methyl-coenzyme m reductase from methanopyrus kandleri
PDB Compounds: (A:) methyl-coenzyme m reductase I alpha subunit

SCOPe Domain Sequences for d1e6va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e6va2 d.58.31.2 (A:8-272) Alpha chain {Methanopyrus kandleri [TaxId: 2320]}
lfmkalkekfeespeekytkfyifggwkqserkkefkewadkiveergvphynpdigvpl
gqrklmsyqvsgtdvfvegddltfvnnaamqqmwddirrtvivgmdtahrvlerrlgkev
tpetineymetlnhalpggavvqehmveihpgltwdcyakiitgdleladeiddkflidi
eklfpeeqaeqlikaignrtyqvcrmptivghvcdgatmyrwaamqiamsficaykiaag
eaavsdfafaskhaevinmgemlpa

SCOPe Domain Coordinates for d1e6va2:

Click to download the PDB-style file with coordinates for d1e6va2.
(The format of our PDB-style files is described here.)

Timeline for d1e6va2: