Lineage for d1e32a2 (1e32 A:201-458)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2127737Family c.37.1.20: Extended AAA-ATPase domain [81269] (29 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2127944Protein Membrane fusion ATPase VCP/p97 [64038] (2 species)
  7. 2127972Species Mouse (Mus musculus) [TaxId:10090] [64039] (4 PDB entries)
  8. 2127973Domain d1e32a2: 1e32 A:201-458 [59184]
    Other proteins in same PDB: d1e32a1, d1e32a3
    D1 domain from the N-D1 fragment
    complexed with adp

Details for d1e32a2

PDB Entry: 1e32 (more details), 2.9 Å

PDB Description: structure of the n-terminal domain and the d1 aaa domain of membrane fusion atpase p97
PDB Compounds: (A:) p97

SCOPe Domain Sequences for d1e32a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]}
vgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
vmnslavtmddfrwalsq

SCOPe Domain Coordinates for d1e32a2:

Click to download the PDB-style file with coordinates for d1e32a2.
(The format of our PDB-style files is described here.)

Timeline for d1e32a2: