Lineage for d1duxc_ (1dux C:)
- Root: SCOPe 2.03
Class a: All alpha proteins [46456] (284 folds) 
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and downSuperfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) 
contains a small beta-sheet (wing)
Family a.4.5.21: ets domain [46859] (9 proteins) 
Protein Elk-1 [46871] (1 species) Species Human (Homo sapiens) [TaxId:9606] [46872] (1 PDB entry) 
Domain d1duxc_: 1dux C: [16170]
protein/DNA complex
Details for d1duxc_
PDB Entry: 1dux (more details), 2.1 Å
PDB Description: elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition
PDB Compounds: (C:) ets-domain protein elk-1SCOPe Domain Sequences for d1duxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]}
vtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydklsral
ryyydkniirkvsgqkfvykfvsype
SCOPe Domain Coordinates for d1duxc_:
Click to download the PDB-style file with coordinates for d1duxc_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1duxc_:
- d1duxc_ first appeared (with stable ids) in SCOP 1.55
- d1duxc_ appears in SCOPe 2.02
- d1duxc_ appears in SCOPe 2.04
- d1duxc_ appears in the current release, SCOPe 2.08
View in 3D
