Lineage for d1duxc_ (1dux C:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 1223Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (11 superfamilies)
  4. 1432Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (26 families) (S)
  5. 1583Family a.4.5.21: ets domain [46859] (6 proteins)
  6. 1584Protein Elk-1 [46871] (1 species)
  7. 1585Species Human (Homo sapiens) [TaxId:9606] [46872] (1 PDB entry)
  8. 1586Domain d1duxc_: 1dux C: [16170]

Details for d1duxc_

PDB Entry: 1dux (more details), 2.1 Å

PDB Description: elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition

SCOP Domain Sequences for d1duxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens)}
vtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydklsral
ryyydkniirkvsgqkfvykfvsype

SCOP Domain Coordinates for d1duxc_:

Click to download the PDB-style file with coordinates for d1duxc_.
(The format of our PDB-style files is described here.)

Timeline for d1duxc_:

1586
d1duxc_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1duxf_