SCOPe 2.04: Domain d1duxc_: 1dux C:

Lineage for d1duxc_ (1dux C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.21: ets domain [46859] (9 proteins)

6. Protein Elk-1 [46871] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46872] (1 PDB entry)

8. Domain d1duxc_: 1dux C: [16170]
   protein/DNA complex

Details for d1duxc_

PDB Entry: 1dux, 2.1 Å

PDB Description: elk-1/dna structure reveals how residues distal from dna-binding surface affect dna-recognition

PDB Compounds: (C:) ets-domain protein elk-1

SCOPe Domain Sequences for d1duxc_:

Sequence; same for both SEQRES and ATOM records:

>d1duxc_ a.4.5.21 (C:) Elk-1 {Human (Homo sapiens) [TaxId: 9606]}
vtlwqfllqllreqgnghiiswtsrdggefklvdaeevarlwglrknktnmnydklsral
ryyydkniirkvsgqkfvykfvsype

Timeline for d1duxc_:

• d1duxc_ first appeared (with stable ids) in SCOP 1.55
  
• d1duxc_ appears in SCOPe 2.03
  
• d1duxc_ appears in SCOPe 2.05
  
• d1duxc_ appears in the current release, SCOPe 2.08