Lineage for d1czva_ (1czv A:)
- Root: SCOPe 2.01
Class b: All beta proteins [48724] (174 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-rollSuperfamily b.18.1: Galactose-binding domain-like [49785] (33 families) 
Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) 
Protein C2 domain of factor V [49792] (2 species) Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries) 
Domain d1czva_: 1czv A: [23716]
Details for d1czva_
PDB Entry: 1czv (more details), 2.4 Å
PDB Description: crystal structure of the c2 domain of human coagulation factor v: dimeric crystal form
PDB Compounds: (A:) protein (coagulation factor v)SCOPe Domain Sequences for d1czva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czva_ b.18.1.2 (A:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]}
cstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwlei
dllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntntk
ghvknffnppiisrfirvipktwnqsitlrlelfgcdiy
SCOPe Domain Coordinates for d1czva_:
Click to download the PDB-style file with coordinates for d1czva_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1czva_:
- d1czva_ first appeared (with stable ids) in SCOP 1.55
- d1czva_ appears in SCOP 1.75
- d1czva_ appears in SCOPe 2.02
- d1czva_ appears in the current release, SCOPe 2.08
View in 3D
