Class b: All beta proteins [48724] (174 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (33 families) |
Family b.18.1.2: Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) [49791] (4 proteins) |
Protein C2 domain of factor V [49792] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [49793] (3 PDB entries) |
Domain d1czvb_: 1czv B: [23717] |
PDB Entry: 1czv (more details), 2.4 Å
SCOPe Domain Sequences for d1czvb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1czvb_ b.18.1.2 (B:) C2 domain of factor V {Human (Homo sapiens) [TaxId: 9606]} cstplgmengkienkqitassfkkswwgdywepfrarlnaqgrvnawqakannnkqwlei dllkikkitaiitqgckslssemyvksytihyseqgvewkpyrlkssmvdkifegntntk ghvknffnppiisrfirvipktwnqsitlrlelfgcdiy
Timeline for d1czvb_: