Lineage for d1bosa_ (1bos A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1123681Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1123908Superfamily b.40.2: Bacterial enterotoxins [50203] (2 families) (S)
  5. 1123909Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins)
  6. 1124222Protein Verotoxin-1/shiga-toxin, B-pentamer [50210] (4 species)
    phage-borne toxin; bacteriophages H30 and H19B
  7. 1124229Species Escherichia coli [TaxId:562] [50211] (13 PDB entries)
  8. 1124275Domain d1bosa_: 1bos A: [25075]
    complexed with gal

Details for d1bosa_

PDB Entry: 1bos (more details), 2.8 Å

PDB Description: shiga-like toxin complexed with its receptor
PDB Compounds: (A:) shiga-like toxin I b subunit

SCOPe Domain Sequences for d1bosa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bosa_ b.40.2.1 (A:) Verotoxin-1/shiga-toxin, B-pentamer {Escherichia coli [TaxId: 562]}
tpdcvtgkveytkyndddtftvkvgdkelftnrwnlqslllsaqitgmtvtiktnachng
ggfsevifr

SCOPe Domain Coordinates for d1bosa_:

Click to download the PDB-style file with coordinates for d1bosa_.
(The format of our PDB-style files is described here.)

Timeline for d1bosa_: