Lineage for d1b23p2 (1b23 P:313-405)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2793864Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2793865Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2793866Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. 2793894Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. 2793918Species Thermus aquaticus [TaxId:271] [50469] (4 PDB entries)
  8. 2793926Domain d1b23p2: 1b23 P:313-405 [25729]
    Other proteins in same PDB: d1b23p1, d1b23p3
    protein/RNA complex; complexed with cys, gnp, mg, so4

Details for d1b23p2

PDB Entry: 1b23 (more details), 2.6 Å

PDB Description: e. coli cysteinyl-trna and t. aquaticus elongation factor ef-tu:gtp ternary complex
PDB Compounds: (P:) elongation factor tu

SCOPe Domain Sequences for d1b23p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b23p2 b.44.1.1 (P:313-405) Elongation factor Tu (EF-Tu) {Thermus aquaticus [TaxId: 271]}
htkfeasvyilkkeeggrhtgfftgyrpqfyfrttdvtgvvrlpqgvemvmpgdnvtftv
elikpvaleeglrfaireggrtvgagvvtkile

SCOPe Domain Coordinates for d1b23p2:

Click to download the PDB-style file with coordinates for d1b23p2.
(The format of our PDB-style files is described here.)

Timeline for d1b23p2: