PDB entry 7e34

View 7e34 on RCSB PDB site
Description: Crystal structure of SUN1-Speedy A-CDK2
Class: cell cycle
Keywords: Telomere, Meiosis, Kinase, CELL CYCLE
Deposited on 2021-02-08, released 2021-04-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-04-14, with a file datestamp of 2021-04-09.
Experiment type: XRAY
Resolution: 3.19 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CDK2, CDKN2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24941 (1-297)
      • expression tag (0)
    Domains in SCOPe 2.08: d7e34a1, d7e34a2
  • Chain 'B':
    Compound: Speedy protein A
    Species: Homo sapiens [TaxId:9606]
    Gene: SPDYA, SPDY1, SPY1
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: SUN domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SUN1, KIAA0810, UNC84A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GOL, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >7e34A (A:)
senfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh
pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs
hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy
stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf
pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.