PDB entry 6fol

View 6fol on RCSB PDB site
Description: Domain II of the human copper chaperone in complex with human Cu,Zn superoxide dismutase
Class: metal binding protein
Keywords: heterodimer, copper-chaperone, hSOD1, protein maturation, METAL BINDING PROTEIN
Deposited on 2018-02-07, released 2019-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-30, with a file datestamp of 2019-01-25.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fola_
  • Chain 'B':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (56)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d6folb_
  • Chain 'C':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (56)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d6folc_
  • Chain 'D':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6fold_
  • Chain 'E':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14618 (2-149)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d6fole1, d6fole2
  • Chain 'F':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (56)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d6folf_
  • Chain 'G':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Homo sapiens [TaxId:9606]
    Gene: SOD1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00441 (0-152)
      • engineered mutation (56)
      • engineered mutation (145)
    Domains in SCOPe 2.07: d6folg_
  • Chain 'H':
    Compound: copper chaperone for superoxide dismutase
    Species: Homo sapiens [TaxId:9606]
    Gene: CCS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d6folh_
  • Heterogens: ZN, PE8, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >6folA (A:)
    ganlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncn
    scgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliide
    geddlgrgghplskitgnsgerlacgiiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6folA (A:)
    nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
    gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
    ddlgrgghplskitgnsgerlacgiiar
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6folB (B:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6folC (C:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >6folD (D:)
    ganlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncn
    scgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliide
    geddlgrgghplskitgnsgerlacgiiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6folD (D:)
    nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
    gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
    ddlgrgghplskitgnsgerlacgiiar
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6folE (E:)
    ganlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncn
    scgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliide
    geddlgrgghplskitgnsgerlacgiiar
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6folF (F:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >6folG (G:)
    atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagatsa
    gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhciigrtlvvh
    ekaddlgkggneestktgnagsrlaagvigiaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >6folH (H:)
    ganlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncn
    scgnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliide
    geddlgrgghplskitgnsgerlacgiiar
    

    Sequence, based on observed residues (ATOM records): (download)
    >6folH (H:)
    nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
    gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
    ddlgrgghplskitgnsgerlacgiiar