SCOPe 2.08: Domain d6folh_: 6fol H:

Lineage for d6folh_ (6fol H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Copper chaperone for superoxide dismutase, C-terminal domain [49341] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49343] (4 PDB entries)

8. Domain d6folh_: 6fol H: [363328]
   Other proteins in same PDB: d6folb_, d6folc_, d6fole2, d6folf_, d6folg_
   automated match to d1do5a_
   complexed with gol, pe8, zn

Details for d6folh_

PDB Entry: 6fol, 2.55 Å

PDB Description: domain ii of the human copper chaperone in complex with human cu,zn superoxide dismutase

PDB Compounds: (H:) copper chaperone for superoxide dismutase

SCOPe Domain Sequences for d6folh_:

Sequence; same for both SEQRES and ATOM records:

>d6folh_ b.1.8.1 (H:) Copper chaperone for superoxide dismutase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
nlgaavailggpgtvqgvvrflqltpercliegtidglepglhglhvhqygdltnncnsc
gnhfnpdgashggpqdsdrhrgdlgnvradadgraifrmedeqlkvwdvigrsliidege
ddlgrgghplskitgnsgerlacgiiar

Timeline for d6folh_:

• d6folh_ first appeared in SCOPe 2.07