PDB entry 5wq0

View 5wq0 on RCSB PDB site
Description: Receiver domain of Spo0A from Paenisporosarcina sp. TG-14
Class: signaling protein
Keywords: Spo0A, Paenisporosarcina sp. TG-14, SIGNALING PROTEIN
Deposited on 2016-11-22, released 2017-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Stage 0 sporulation protein
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQ0
    Domains in SCOPe 2.07: d5wq0a_
  • Chain 'B':
    Compound: Stage 0 sporulation protein
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQ0 (0-End)
    Domains in SCOPe 2.07: d5wq0b_
  • Chain 'C':
    Compound: Stage 0 sporulation protein
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQ0
    Domains in SCOPe 2.07: d5wq0c_
  • Chain 'D':
    Compound: Stage 0 sporulation protein
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQ0 (0-End)
    Domains in SCOPe 2.07: d5wq0d_
  • Chain 'E':
    Compound: Stage 0 sporulation protein
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQ0
    Domains in SCOPe 2.07: d5wq0e_
  • Chain 'F':
    Compound: Stage 0 sporulation protein
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQ0 (0-End)
    Domains in SCOPe 2.07: d5wq0f_
  • Chain 'G':
    Compound: Stage 0 sporulation protein
    Species: Paenisporosarcina sp. TG-14 [TaxId:1231057]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WQ0
    Domains in SCOPe 2.07: d5wq0g_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wq0A (A:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvaghkqeadqrssilqsqpqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq0A (A:)
    kikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimphl
    dglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqilqv
    agh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wq0B (B:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvaghkqeadqrssilqsqpqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq0B (B:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvaghk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wq0C (C:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvaghkqeadqrssilqsqpqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq0C (C:)
    ekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimph
    ldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqilq
    vag
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5wq0D (D:)
    gshmmekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllld
    iimphldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrld
    nqilqvaghkqeadqrssilqsqpqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq0D (D:)
    gshmmekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllld
    iimphldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrld
    nqilqvagh
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5wq0E (E:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvaghkqeadqrssilqsqpqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq0E (E:)
    ekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimph
    ldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqilq
    vag
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5wq0F (F:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvaghkqeadqrssilqsqpqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq0F (F:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvagh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5wq0G (G:)
    mekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimp
    hldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqil
    qvaghkqeadqrssilqsqpqpkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wq0G (G:)
    ekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllldiimph
    ldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrlvnqilq
    vagh