SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wq0d_ (5wq0 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (69 species)
    not a true protein
  7. 2288908Species Paenisporosarcina sp. [TaxId:1231057] [332209] (1 PDB entry)
  8. 2288984Domain d5wq0d_: 5wq0 D: [332285]
    automated match to d2mska_
    complexed with mg

Details for d5wq0d_

PDB Entry: 5wq0 (more details), 2.6 Å

PDB Description: receiver domain of spo0a from paenisporosarcina sp. tg-14
PDB Compounds: (D:) Stage 0 sporulation protein

SCOPe Domain Sequences for d5wq0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wq0d_ c.23.1.0 (D:) automated matches {Paenisporosarcina sp. [TaxId: 1231057]}
gshmmekikvaiaddnkelvktlesyladhpqievittapngkvilslmendlpdvllld
iimphldglavlemmqanenlskvqvimltafgqedvmkqavdlgasyfmlkpfefdrld
nqilqvagh

SCOPe Domain Coordinates for d5wq0d_:

Click to download the PDB-style file with coordinates for d5wq0d_.
(The format of our PDB-style files is described here.)

Timeline for d5wq0d_:

  • d5wq0d_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-23