PDB entry 5vsi

View 5vsi on RCSB PDB site
Description: CH1/Ckappa Fab mutant 15.1
Class: immune system
Keywords: bispecific antibody, computational design, heavy chain/light chain interface, CH1/Ckappa interface, IMMUNE SYSTEM
Deposited on 2017-05-11, released 2017-08-02
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-02, with a file datestamp of 2017-07-28.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CH1/Ckappa Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VSI (0-106)
    • Uniprot Q6GMX6 (107-220)
      • engineered mutation (150)
      • engineered mutation (186)
      • engineered mutation (216)
  • Chain 'L':
    Compound: CH1/Ckappa Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VSI (0-105)
    • Uniprot Q7Z3Y4 (106-211)
      • engineered mutation (121)
      • engineered mutation (129)
      • engineered mutation (174)
    Domains in SCOPe 2.06: d5vsil1, d5vsil2
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5vsiL (L:)
diqmtqspsslsasvgdrvtitcsasssvtymywyqqkpgkapklliydtsnlasgvpsr
fsgsgsgtdytftisslqpediatyycqqwsshiftfgqgtkveikrtvaapsvfifpps
dkqlksgtarvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslistltl
skadyekhkvyacevthqglsspvtksfnrge