SCOPe 2.06: Domain d5vsil1: 5vsi L:1-105

Lineage for d5vsil1 (5vsi L:1-105)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5vsil1: 5vsi L:1-105 [337364]
   Other proteins in same PDB: d5vsil2
   automated match to d1dn0a1
   complexed with edo, so4; mutant

Details for d5vsil1

PDB Entry: 5vsi, 1.51 Å

PDB Description: ch1/ckappa fab mutant 15.1

PDB Compounds: (L:) CH1/Ckappa Fab light chain

SCOPe Domain Sequences for d5vsil1:

Sequence; same for both SEQRES and ATOM records:

>d5vsil1 b.1.1.0 (L:1-105) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcsasssvtymywyqqkpgkapklliydtsnlasgvpsr
fsgsgsgtdytftisslqpediatyycqqwsshiftfgqgtkvei

Timeline for d5vsil1:

• d5vsil1 is new in SCOPe 2.06-stable
  
• d5vsil1 appears in SCOPe 2.07
  
• d5vsil1 appears in the current release, SCOPe 2.08