PDB entry 5vo7

View 5vo7 on RCSB PDB site
Description: NMR Assignment and Structure of Thioredoxin (Rv1471 ortholog) from Mycobacterium smegmatis ATCC 700084 / mc(2)155
Class: electron transport
Keywords: PROTEIN NMR Thioredoxin Mycobacterium smegmatis, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, SSGCID, PROTEIN, ELECTRON TRANSPORT
Deposited on 2017-05-02, released 2017-06-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-07, with a file datestamp of 2017-06-02.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Mycobacterium smegmatis [TaxId:1772]
    Gene: trxA_2, ERS451418_06713
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vo7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5vo7A (A:)
msedsatvavtddsfstdvlgsskpvlvdfwatwcgpckmvapvleeiaaekgdqltvak
idvdanpatardfqvvsiptmilfkdgapvkrivgakgkaallrelsdal