SCOPe 2.06: Domain d5vo7a_: 5vo7 A:

Lineage for d5vo7a_ (5vo7 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:1772] [335269] (1 PDB entry)

8. Domain d5vo7a_: 5vo7 A: [335270]
   automated match to d2l4qa_

Details for d5vo7a_

PDB Entry: 5vo7

PDB Description: nmr assignment and structure of thioredoxin (rv1471 ortholog) from mycobacterium smegmatis atcc 700084 / mc(2)155

PDB Compounds: (A:) thioredoxin

SCOPe Domain Sequences for d5vo7a_:

Sequence; same for both SEQRES and ATOM records:

>d5vo7a_ c.47.1.0 (A:) automated matches {Mycobacterium smegmatis [TaxId: 1772]}
msedsatvavtddsfstdvlgsskpvlvdfwatwcgpckmvapvleeiaaekgdqltvak
idvdanpatardfqvvsiptmilfkdgapvkrivgakgkaallrelsdal

Timeline for d5vo7a_:

• d5vo7a_ is new in SCOPe 2.06-stable
  
• d5vo7a_ appears in SCOPe 2.07
  
• d5vo7a_ appears in the current release, SCOPe 2.08