PDB entry 5osi

View 5osi on RCSB PDB site
Description: Legionella effector
Class: transport protein
Keywords: Retromer, Legionella pneumophila, TRANSPORT PROTEIN
Deposited on 2017-08-17, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 2.52 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Vacuolar protein sorting-associated protein 29
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS29, DC15, DC7, MDS007
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBQ0 (0-181)
  Domains in SCOPe 2.06: d5osia_
• Chain 'B':
  Compound: Vacuolar protein sorting-associated protein 35
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS35, MEM3, TCCCTA00141
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96QK1
• Chain 'C':
  Compound: Interaptin
  Species: Legionella pneumophila subsp. pneumophila ATCC 43290 [TaxId:933093]
  Gene: lp12_2303
  Database cross-references and differences (RAF-indexed):
  • Uniprot G8UZ99
• Chain 'D':
  Compound: Vacuolar protein sorting-associated protein 29
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS29, DC15, DC7, MDS007
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBQ0 (0-181)
  Domains in SCOPe 2.06: d5osid_
• Chain 'E':
  Compound: Vacuolar protein sorting-associated protein 35
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS35, MEM3, TCCCTA00141
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96QK1
• Chain 'F':
  Compound: Interaptin
  Species: Legionella pneumophila subsp. pneumophila ATCC 43290 [TaxId:933093]
  Gene: lp12_2303
  Database cross-references and differences (RAF-indexed):
  • Uniprot G8UZ99
• Chain 'G':
  Compound: Vacuolar protein sorting-associated protein 29
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS29, DC15, DC7, MDS007
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBQ0 (0-181)
  Domains in SCOPe 2.06: d5osig_
• Chain 'H':
  Compound: Vacuolar protein sorting-associated protein 35
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS35, MEM3, TCCCTA00141
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96QK1
• Chain 'I':
  Compound: Interaptin
  Species: Legionella pneumophila subsp. pneumophila ATCC 43290 [TaxId:933093]
  Gene: lp12_2303
  Database cross-references and differences (RAF-indexed):
  • Uniprot G8UZ99
• Chain 'J':
  Compound: Vacuolar protein sorting-associated protein 29
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS29, DC15, DC7, MDS007
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9UBQ0 (0-181)
  Domains in SCOPe 2.06: d5osij_
• Chain 'K':
  Compound: Vacuolar protein sorting-associated protein 35
  Species: Homo sapiens [TaxId:9606]
  Gene: VPS35, MEM3, TCCCTA00141
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q96QK1
• Heterogens: EDO, NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5osiA (A:)
  mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
  gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
  afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
  kp
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5osiD (D:)
  mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
  gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
  afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
  kp
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.
  
  
• Chain 'G':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5osiG (G:)
  mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
  gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
  afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
  kp
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'I':
  No sequence available.
  
  
• Chain 'J':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5osiJ (J:)
  mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr
  gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe
  afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk
  kp
  

  
  
• Chain 'K':
  No sequence available.