Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
Family d.159.1.7: YfcE-like [111233] (5 proteins) |
Protein Vacuolar protein sorting 29, VPS29 [143935] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [160872] (3 PDB entries) |
Domain d5osij_: 5osi J: [342815] automated match to d2r17a_ complexed with edo, na |
PDB Entry: 5osi (more details), 2.52 Å
SCOPe Domain Sequences for d5osij_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5osij_ d.159.1.7 (J:) Vacuolar protein sorting 29, VPS29 {Human (Homo sapiens) [TaxId: 9606]} mlvlvlgdlhiphrcnslpakfkkllvpgkiqhilctgnlctkesydylktlagdvhivr gdfdenlnypeqkvvtvgqfkiglihghqvipwgdmaslallqrqfdvdilisghthkfe afehenkfyinpgsatgaynaletniipsfvlmdiqastvvtyvyqligddvkverieyk kp
Timeline for d5osij_: