PDB entry 5ldd

View 5ldd on RCSB PDB site
Description: Crystal structure of the heterodimeric GEF Mon1-Ccz1 in complex with Ypt7
Class: protein transport
Keywords: heterodimeric GEF protein, endosomal maturation, Rab GTPase, protein transport
Deposited on 2016-06-24, released 2017-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-18, with a file datestamp of 2017-01-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mon1
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0067370
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ccz1
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0050970
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Rab small monomeric GTPase-like protein
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0065990
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SGE1
      • engineered mutation (126)
    Domains in SCOPe 2.07: d5lddc_
  • Chain 'D':
    Compound: Mon1
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0067370
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Ccz1
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0050970
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Rab small monomeric GTPase-like protein
    Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
    Gene: CTHT_0065990
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0SGE1
      • engineered mutation (126)
    Domains in SCOPe 2.07: d5lddf_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5lddC (C:)
    gsmssrkkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvt
    mqlwdtagqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenf
    pfvvlgikidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq
    eeseefsgdfqdpinihienerdgcac
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lddC (C:)
    kkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdt
    agqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlg
    ikikrvistkraqtfcqskggipyfetsakainveeafqviarnalmq
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5lddF (F:)
    gsmssrkkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvt
    mqlwdtagqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenf
    pfvvlgikidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq
    eeseefsgdfqdpinihienerdgcac
    

    Sequence, based on observed residues (ATOM records): (download)
    >5lddF (F:)
    kvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvrqvtmqlwdtagq
    erfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasppenfpfvvlgikkrv
    istkraqtfcqskggipyfetsnveeafqviarnalmq