PDB entry 5ldd

View 5ldd on RCSB PDB site
Description: Crystal structure of the heterodimeric GEF Mon1-Ccz1 in complex with Ypt7
Class: protein transport
Keywords: heterodimeric GEF protein, endosomal maturation, Rab GTPase, protein transport
Deposited on 2016-06-24, released 2017-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Mon1
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0067370
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SGS3
• Chain 'B':
  Compound: Ccz1
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0050970
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SD94
• Chain 'C':
  Compound: Rab small monomeric GTPase-like protein
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0065990
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SGE1
    • engineered mutation (126)
  Domains in SCOPe 2.08: d5lddc_
• Chain 'D':
  Compound: Mon1
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0067370
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SGS3
• Chain 'E':
  Compound: Ccz1
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0050970
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SD94
• Chain 'F':
  Compound: Rab small monomeric GTPase-like protein
  Species: Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) [TaxId:759272]
  Gene: CTHT_0065990
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0SGE1
    • engineered mutation (126)
  Domains in SCOPe 2.08: d5lddf_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >5lddC (C:)
  gsmssrkkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvt
  mqlwdtagqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenf
  pfvvlgikidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq
  eeseefsgdfqdpinihienerdgcac
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5lddC (C:)
  kkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdt
  agqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlg
  ikikrvistkraqtfcqskggipyfetsakainveeafqviarnalmq
  

  
  
• Chain 'D':
  No sequence available.
  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  Sequence, based on SEQRES records: (download)
  

  >5lddF (F:)
  gsmssrkkvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvt
  mqlwdtagqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenf
  pfvvlgikidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq
  eeseefsgdfqdpinihienerdgcac
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5lddF (F:)
  kvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvrqvtmqlwdtagq
  erfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasppenfpfvvlgikkrv
  istkraqtfcqskggipyfetsnveeafqviarnalmq