SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5lddf_ (5ldd F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (125 species)
    not a true protein
  7. 2285287Species Chaetomium thermophilum [TaxId:759272] [328588] (1 PDB entry)
  8. 2285322Domain d5lddf_: 5ldd F: [328623]
    automated match to d1ukvy_
    complexed with so4

Details for d5lddf_

PDB Entry: 5ldd (more details), 2.5 Å

PDB Description: crystal structure of the heterodimeric gef mon1-ccz1 in complex with ypt7
PDB Compounds: (F:) Rab small monomeric GTPase-like protein

SCOPe Domain Sequences for d5lddf_:

Sequence, based on SEQRES records: (download)

>d5lddf_ c.37.1.0 (F:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdta
gqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlgi
kidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq

Sequence, based on observed residues (ATOM records): (download)

>d5lddf_ c.37.1.0 (F:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvrqvtmqlwdtagq
erfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasppenfpfvvlgikkrv
istkraqtfcqskggipyfetsnveeafqviarnalmq

SCOPe Domain Coordinates for d5lddf_:

Click to download the PDB-style file with coordinates for d5lddf_.
(The format of our PDB-style files is described here.)

Timeline for d5lddf_:

  • d5lddf_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19