Lineage for d5lddf_ (5ldd F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (127 species)
    not a true protein
  7. 2285287Species Chaetomium thermophilum [TaxId:759272] [328588] (1 PDB entry)
  8. 2285322Domain d5lddf_: 5ldd F: [328623]
    automated match to d1ukvy_
    complexed with so4

Details for d5lddf_

PDB Entry: 5ldd (more details), 2.5 Å

PDB Description: crystal structure of the heterodimeric gef mon1-ccz1 in complex with ypt7
PDB Compounds: (F:) Rab small monomeric GTPase-like protein

SCOPe Domain Sequences for d5lddf_:

Sequence, based on SEQRES records: (download)

>d5lddf_ c.37.1.0 (F:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvddrqvtmqlwdta
gqerfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasprdpenfpfvvlgi
kidveeskrvistkraqtfcqskggipyfetsakeainveeafqviarnalmq

Sequence, based on observed residues (ATOM records): (download)

>d5lddf_ c.37.1.0 (F:) automated matches {Chaetomium thermophilum [TaxId: 759272]}
kvllkviilgdsgvgktslmnqyvnkkfsasykatigadfltrevmvrqvtmqlwdtagq
erfqslgvafyrgadccvlvfdvnnaksfdaldswrdefliqasppenfpfvvlgikkrv
istkraqtfcqskggipyfetsnveeafqviarnalmq

SCOPe Domain Coordinates for d5lddf_:

Click to download the PDB-style file with coordinates for d5lddf_.
(The format of our PDB-style files is described here.)

Timeline for d5lddf_:

  • d5lddf_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-19