PDB entry 5l1y

View 5l1y on RCSB PDB site
Description: Solution structure of a Bcl-xL S62E mutant
Class: apoptosis
Keywords: Apoptosis
Deposited on 2016-07-29, released 2017-08-09
Made obsolete by 6bf2 on 2017-11-08

The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bcl-2-like protein 1
  Species: Homo sapiens [TaxId:9606]
  Gene: BCL2L1, BCL2L, BCLX
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07817 (3-211)
    • expression tag (0-2)
    • engineered mutation (64)
  Domains in SCOPe 2.06: d5l1ya1, d5l1ya2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5l1yA (A:)
  ghsmsqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpsw
  hladepavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpg
  tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndh
  lepwiqenggwdtfvelygnnaaaesrkgqer