Lineage for d5l1ya1 (5l1y A:4-212)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250926Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) (S)
    PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain
  5. 2250927Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 protein domains)
    Pfam PF00452
  6. 2250933Protein Apoptosis regulator Bcl-xL [56856] (3 species)
  7. 2250934Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)
  8. 2250973Domain d5l1ya1: 5l1y A:4-212 [337565]
    Other proteins in same PDB: d5l1ya2
    automated match to d1r2ia_
    mutant

Details for d5l1ya1

PDB Entry: 5l1y (more details)

PDB Description: solution structure of a bcl-xl s62e mutant
PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d5l1ya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l1ya1 f.1.4.1 (A:4-212) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegtesemetpsaingnpswhla
depavngatghsssldarevipmaavkqalreagdefelryrrafsdltsqlhitpgtay
qsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndhlep
wiqenggwdtfvelygnnaaaesrkgqer

SCOPe Domain Coordinates for d5l1ya1:

Click to download the PDB-style file with coordinates for d5l1ya1.
(The format of our PDB-style files is described here.)

Timeline for d5l1ya1:

  • d5l1ya1 appears in periodic updates to SCOPe 2.06 starting on 2017-08-10
  • d5l1ya1 became obsolete in SCOPe 2.07

View in 3D
Domains from same chain:
(mouse over for more information)
d5l1ya2