PDB entry 5iun

View 5iun on RCSB PDB site
Description: Crystal structure of the DesK-DesR complex in the phosphatase state
Class: transferase/gene regulation
Keywords: Two-component regulatory system, Kinase, Response regulator, Phosphatase complex, Dephosphorylation, TRANSFERASE, TRANSFERASE-GENE REGULATION complex
Deposited on 2016-03-18, released 2016-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (3-End)
      • expression tag (2)
      • engineered mutation (3)
      • engineered mutation (6)
      • engineered mutation (10)
  • Chain 'B':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (3-End)
      • engineered mutation (3)
      • engineered mutation (6)
      • engineered mutation (10)
  • Chain 'C':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34723 (4-End)
      • expression tag (3)
    Domains in SCOPe 2.07: d5iunc1, d5iunc2
  • Chain 'D':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iund_
  • Chain 'E':
    Compound: Sensor histidine kinase desK
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: desK, yocF, BSU19190
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34757 (3-End)
      • engineered mutation (3)
      • engineered mutation (6)
      • engineered mutation (10)
  • Chain 'F':
    Compound: Transcriptional regulatory protein DesR
    Species: Bacillus subtilis (strain 168) [TaxId:224308]
    Gene: desR, yocG, BSU19200
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5iunf_
  • Heterogens: ACP, MG, MES, BEF, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5iunC (C:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iunC (C:)
    smisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempg
    ktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmng
    kriyapelmed
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5iunD (D:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iunD (D:)
    misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
    tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
    riyapelmed
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5iunF (F:)
    gsgsmisifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdie
    mpgktgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsv
    mngkriyapelmedlysea
    

    Sequence, based on observed residues (ATOM records): (download)
    >5iunF (F:)
    misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
    tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
    riyapelme