Lineage for d5iund_ (5iun D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (71 species)
    not a true protein
  7. 2101986Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2284054Domain d5iund_: 5iun D: [327355]
    Other proteins in same PDB: d5iunc2
    automated match to d4le0b_
    complexed with acp, bef, mes, mg, so4

Details for d5iund_

PDB Entry: 5iun (more details), 2.79 Å

PDB Description: crystal structure of the desk-desr complex in the phosphatase state
PDB Compounds: (D:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d5iund_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iund_ c.23.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmed

SCOPe Domain Coordinates for d5iund_:

Click to download the PDB-style file with coordinates for d5iund_.
(The format of our PDB-style files is described here.)

Timeline for d5iund_:

  • d5iund_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22