SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5iund_ (5iun D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2101601Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 2101973Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 2101974Protein automated matches [190131] (68 species)
    not a true protein
  7. 2101986Species Bacillus subtilis [TaxId:224308] [257830] (6 PDB entries)
  8. 2284054Domain d5iund_: 5iun D: [327355]
    Other proteins in same PDB: d5iunc2
    automated match to d4le0b_
    complexed with acp, bef, mes, mg, so4

Details for d5iund_

PDB Entry: 5iun (more details), 2.79 Å

PDB Description: crystal structure of the desk-desr complex in the phosphatase state
PDB Compounds: (D:) Transcriptional regulatory protein DesR

SCOPe Domain Sequences for d5iund_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iund_ c.23.1.0 (D:) automated matches {Bacillus subtilis [TaxId: 224308]}
misifiaedqqmllgalgsllnleddmevvgkgttgqdavdfvkkrqpdvcimdiempgk
tgleaaeelkdtgckiiilttfarpgyfqraikagvkgyllkdspseelanairsvmngk
riyapelmed

SCOPe Domain Coordinates for d5iund_:

Click to download the PDB-style file with coordinates for d5iund_.
(The format of our PDB-style files is described here.)

Timeline for d5iund_:

  • d5iund_ appears in periodic updates to SCOPe 2.06 starting on 2016-12-22