PDB entry 5hzc

View 5hzc on RCSB PDB site
Description: Crystal structure of the complex PPARgamma/AL26-29
Class: transcription
Keywords: Nuclear receptor, transcription factor, diabetes, bundle of alpha-helices, transcription
Deposited on 2016-02-02, released 2016-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-11-23, with a file datestamp of 2016-11-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hzca_
  • Chain 'B':
    Compound: Peroxisome proliferator-activated receptor gamma
    Species: Homo sapiens [TaxId:9606]
    Gene: PPARG, NR1C3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hzcb_
  • Heterogens: 65W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hzcA (A:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzcA (A:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgevairifq
    gcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlise
    gqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
    kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdm
    slhpllqeiyk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hzcB (B:)
    gshmaeissdidqlnpesadlralakhlydsyiksfpltkakarailtgkttdkspfviy
    dmnslmmgedkikfkhitplqeqskevairifqgcqfrsveavqeiteyaksipgfvnld
    lndqvtllkygvheiiytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfef
    avkfnalelddsdlaifiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessq
    lfakllqkmtdlrqivtehvqllqvikktetdmslhpllqeiykdly
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hzcB (B:)
    esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgkevairif
    qgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlis
    egqgfmtreflkslkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
    kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdm
    slhpllqeiy