SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hzca_ (5hzc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008960Protein Peroxisome proliferator activated receptor gamma, PPAR-gamma [48524] (1 species)
  7. 2008961Species Human (Homo sapiens) [TaxId:9606] [48525] (105 PDB entries)
    Uniprot P37231 232-505
  8. 2283171Domain d5hzca_: 5hzc A: [326472]
    automated match to d1nyxa_
    complexed with 65w

Details for d5hzca_

PDB Entry: 5hzc (more details), 2 Å

PDB Description: crystal structure of the complex ppargamma/al26-29
PDB Compounds: (A:) Peroxisome proliferator-activated receptor gamma

SCOPe Domain Sequences for d5hzca_:

Sequence, based on SEQRES records: (download)

>d5hzca_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgedkikfkh
itplqeqskevairifqgcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheii
ytmlaslmnkdgvlisegqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlai
fiaviilsgdrpgllnvkpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqiv
tehvqllqvikktetdmslhpllqeiyk

Sequence, based on observed residues (ATOM records): (download)

>d5hzca_ a.123.1.1 (A:) Peroxisome proliferator activated receptor gamma, PPAR-gamma {Human (Homo sapiens) [TaxId: 9606]}
esadlralakhlydsyiksfpltkakarailtgkttdkspfviydmnslmmgevairifq
gcqfrsveavqeiteyaksipgfvnldlndqvtllkygvheiiytmlaslmnkdgvlise
gqgfmtreflkslrkpfgdfmepkfefavkfnalelddsdlaifiaviilsgdrpgllnv
kpiediqdnllqalelqlklnhpessqlfakllqkmtdlrqivtehvqllqvikktetdm
slhpllqeiyk

SCOPe Domain Coordinates for d5hzca_:

Click to download the PDB-style file with coordinates for d5hzca_.
(The format of our PDB-style files is described here.)

Timeline for d5hzca_:

  • d5hzca_ appears in periodic updates to SCOPe 2.06 starting on 2016-11-23