PDB entry 5hiz

View 5hiz on RCSB PDB site
Description: The structure of PEDV NSP9
Class: RNA binding protein
Keywords: RNA binding protein
Deposited on 2016-01-12, released 2017-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-01-25, with a file datestamp of 2017-01-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Non-structural protein 9
    Species: Porcine epidemic diarrhea virus CV777 [TaxId:229032]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hiza_
  • Chain 'B':
    Compound: Non-structural protein 9
    Species: Porcine epidemic diarrhea virus CV777 [TaxId:229032]
    Gene: rep, 1a-1b
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5hizb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5hizA (A:)
    nneiipgklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggcn
    tielepprkflvdspngaqikylyfvrnlntlrrgavlgyigatvrlqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hizA (A:)
    gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwggcntielepprk
    flvdspngaqikylyfvrnlntlrrgavlgyigatv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5hizB (B:)
    nneiipgklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggcn
    tielepprkflvdspngaqikylyfvrnlntlrrgavlgyigatvrlqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5hizB (B:)
    gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwggcntielepprk
    flvdspngaqikylyfvrnlntlrrgavlgyigatv