SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5hiza_ (5hiz A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077691Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 2077692Superfamily b.140.1: Replicase NSP9 [101816] (2 families) (S)
  5. 2077705Family b.140.1.0: automated matches [191526] (1 protein)
    not a true family
  6. 2077706Protein automated matches [190886] (3 species)
    not a true protein
  7. 2285579Species Porcine epidemic diarrhea virus cv777 [TaxId:229032] [328880] (2 PDB entries)
  8. 2285649Domain d5hiza_: 5hiz A: [328950]
    automated match to d1qz8a_

Details for d5hiza_

PDB Entry: 5hiz (more details), 2.9 Å

PDB Description: the structure of pedv nsp9
PDB Compounds: (A:) Non-structural protein 9

SCOPe Domain Sequences for d5hiza_:

Sequence, based on SEQRES records: (download)

>d5hiza_ b.140.1.0 (A:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggcntielep
prkflvdspngaqikylyfvrnlntlrrgavlgyigatv

Sequence, based on observed residues (ATOM records): (download)

>d5hiza_ b.140.1.0 (A:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwggcntielepprk
flvdspngaqikylyfvrnlntlrrgavlgyigatv

SCOPe Domain Coordinates for d5hiza_:

Click to download the PDB-style file with coordinates for d5hiza_.
(The format of our PDB-style files is described here.)

Timeline for d5hiza_:

  • d5hiza_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from other chains:
(mouse over for more information)
d5hizb_