Lineage for d5hiza_ (5hiz A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2077691Fold b.140: Replicase NSP9 [101815] (1 superfamily)
    barrel; n=6, S=8, greek-key; similar to one trypsin-like protease barrel
  4. 2077692Superfamily b.140.1: Replicase NSP9 [101816] (2 families) (S)
  5. 2077705Family b.140.1.0: automated matches [191526] (1 protein)
    not a true family
  6. 2077706Protein automated matches [190886] (3 species)
    not a true protein
  7. 2285579Species Porcine epidemic diarrhea virus cv777 [TaxId:229032] [328880] (2 PDB entries)
  8. 2285649Domain d5hiza_: 5hiz A: [328950]
    automated match to d1qz8a_

Details for d5hiza_

PDB Entry: 5hiz (more details), 2.9 Å

PDB Description: the structure of pedv nsp9
PDB Compounds: (A:) Non-structural protein 9

SCOPe Domain Sequences for d5hiza_:

Sequence, based on SEQRES records: (download)

>d5hiza_ b.140.1.0 (A:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwefdggcntielep
prkflvdspngaqikylyfvrnlntlrrgavlgyigatv

Sequence, based on observed residues (ATOM records): (download)

>d5hiza_ b.140.1.0 (A:) automated matches {Porcine epidemic diarrhea virus cv777 [TaxId: 229032]}
gklkqrsikaegdgivgegkalynneggrtfmyafisdkpdlrvvkwggcntielepprk
flvdspngaqikylyfvrnlntlrrgavlgyigatv

SCOPe Domain Coordinates for d5hiza_:

Click to download the PDB-style file with coordinates for d5hiza_.
(The format of our PDB-style files is described here.)

Timeline for d5hiza_:

  • d5hiza_ appears in periodic updates to SCOPe 2.06 starting on 2017-01-26

View in 3D
Domains from other chains:
(mouse over for more information)
d5hizb_