PDB entry 5e4e

View 5e4e on RCSB PDB site
Description: Engineered Interleukin-13 bound to receptor
Class: signaling protein
Keywords: agonist-receptor complex, protein engineering, SIGNALING PROTEIN
Deposited on 2015-10-05, released 2015-12-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13, NC30
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35225 (0-112)
      • engineered mutation (9)
      • engineered mutation (17)
      • engineered mutation (38)
      • engineered mutation (86-87)
      • engineered mutation (100)
      • engineered mutation (103-104)
      • engineered mutation (110)
    Domains in SCOPe 2.07: d5e4ea_
  • Chain 'B':
    Compound: Interleukin-4 receptor subunit alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: IL4R, IL4RA, 582J2.1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5e4eb1, d5e4eb2
  • Chain 'C':
    Compound: Interleukin-13 receptor subunit alpha-1
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13RA1, IL13R, IL13RA
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, NAG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5e4eA (A:)
    pgpvppstavrelieelinitqnqkaplcngsmvwsinrtagmycaaleslinvsgcsai
    ektqrmlsgfcphkvsagqfsslhvrsskievaqfvkdllfhlrtlfregqfn
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e4eA (A:)
    pgpvppstavrelieelinitqnaplcngsmvwsinrtagmycaaleslinvsgcsaiek
    tqrmlsgfcphkvsagqfsslhvrsskievaqfvkdllfhlrtlfregqfn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5e4eB (B:)
    mkvlqeptcvsdymsistcewkmngptncstelrllyqlvfllseahtcipennggagcv
    chllmddvvsadnytldlwagqqllwkgsfkpsehvkprapgnltvhtnvsdtllltwsn
    pyppdnylynhltyavniwsendpadfriynvtylepslriaastlksgisyrarvrawa
    qcynttwsewspstkwhnsyrep
    

    Sequence, based on observed residues (ATOM records): (download)
    >5e4eB (B:)
    mkvlqeptcvsdymsistcewkmgptncstelrllyqlvfllseahtcipennggagcvc
    hllmddvvsadnytldlwagqqllwkgsfkpsehvkprapgnltvhsdtllltwsnpypp
    dnylynhltyavniwspadfriynvtylepslriaassyrarvrawaqcynttwsewsps
    tkw
    

  • Chain 'C':
    No sequence available.