Lineage for d5e4eb2 (5e4e B:97-196)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2358952Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 2358953Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 2359419Protein automated matches [190888] (1 species)
    not a true protein
  7. 2359420Species Human (Homo sapiens) [TaxId:9606] [188282] (31 PDB entries)
  8. 2359485Domain d5e4eb2: 5e4e B:97-196 [302128]
    Other proteins in same PDB: d5e4ea_
    automated match to d3bplb2
    complexed with nag, so4

Details for d5e4eb2

PDB Entry: 5e4e (more details), 3 Å

PDB Description: engineered interleukin-13 bound to receptor
PDB Compounds: (B:) Interleukin-4 receptor subunit alpha

SCOPe Domain Sequences for d5e4eb2:

Sequence, based on SEQRES records: (download)

>d5e4eb2 b.1.2.1 (B:97-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprapgnltvhtnvsdtllltwsnpyppdnylynhltyavniwsendpadfriynvtyle
pslriaastlksgisyrarvrawaqcynttwsewspstkw

Sequence, based on observed residues (ATOM records): (download)

>d5e4eb2 b.1.2.1 (B:97-196) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kprapgnltvhsdtllltwsnpyppdnylynhltyavniwspadfriynvtylepslria
assyrarvrawaqcynttwsewspstkw

SCOPe Domain Coordinates for d5e4eb2:

Click to download the PDB-style file with coordinates for d5e4eb2.
(The format of our PDB-style files is described here.)

Timeline for d5e4eb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5e4eb1
View in 3D
Domains from other chains:
(mouse over for more information)
d5e4ea_